PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00078g00177.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 428aa    MW: 47421.6 Da    PI: 8.0509
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00078g00177.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32239292255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Peaxi162Scf00078g00177.1 239 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 292
                               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15236292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28237292IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23239292IPR006447Myb domain, plants
PfamPF002497.7E-7240291IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MPLEGVFIEP PSSKRPIPDL SLNISPPNSS SSPSCNNIFS RCTEAGENHG RLEFNKSSNC  60
LTELSLAHPV ATTTNATGIN DEITRRGFPD LPARNPYNNH HSQNYSHMMQ PMNQINHGVS  120
SLDVSDGLKP IKGIPVYHQN RSFPFLANLD KEKDPKMCFY PMTSYPPSNN FSPTSSSPYF  180
NSRFNGISSS YQVPQHHHLH HNHYGVGLGH SHHDTSASHS LMRSRFLPKL PAKRSMRAPR  240
MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDKPA  300
ASSGQSDGSG DDDLTTIGSA GTGDRTGLYR LIDQRTGASD GSLQPESEYP STATPNTLWS  360
NSSSRSEGWL QANTNDANGL RSPCFPSQQR SGHQIEESNS SMPKSFIEKN PSLEFTLGRP  420
DWIDKEHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ4755320.0GQ475532.1 Petunia x hybrida putative KAN protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624603.10.0PREDICTED: transcription repressor KAN1 isoform X1
TrEMBLA0A0V0IFG90.0A0A0V0IFG9_SOLCH; Putative transcription repressor KAN1-like
STRINGPGSC0003DMT4000346630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-56G2-like family protein